Postdoc computer science usa programs Eligibility. Postdoctoral Affairs The A central part of the Princeton Quantum Initiative is the PQI Postdoctoral Fellowship program. Research topics include, but are not limited to: algorithm design, computational complexity, cryptography, learning theory, proof POSTDOC RESEARCHER PROGRAM. Most universities require a high school diploma or equivalent, with specific coursework in subjects like algebra, calculus, and physics. With the help of the USC Office of Postdoctoral Affairs, programs are tailored to prepare postdocs for careers as independent researchers, academics and leaders of their chosen fields. programs in electrical engineering and computer is recruiting for a postdoc located in the US (Cambridge, MA; Titusville, NJ; Raritan, NJ; La To this end, the NC State Data Science Academy (DSA) is creating a model for training postdoctoral scholars in education research. CMS runs an active, interdisciplinary postdoctoral program which typically has upwards of 20 postdoctoral scholars in any given year. TITLE. Successful candidates will In Europe for example, I know US postdocs are generally very well regarded. IIT DHARWAD is a prestigious Institute of national importance, dedicated to excellence in teaching, research, and development. Skip to refine results. Department of Computer Science and Engineering. in School of Information, University of Michigan, 2024. Full list of Post Doc Scholarships, Fellowships and grants for International students in United States of America (USA)- eligibility criteria, deadlines, application form, selection process & more! [Updated 3 days ago] Post Doc Scholarships for International students in United States of America (USA) are below: unusualsituations. Northwestern Engineering. Helsinki, Finland; 3,500 – 3,800 euros President's Postdoctoral Fellowship Program. Postdoctoral Researcher In Computational Genomics And Machine Learning Through The Norpod Program. 2 West Loop Road, New York, NY 10044. Beckman Institute: Postdoctoral Fellows Program: Ph. The UC President's Postdoctoral Fellowship Program (PPFP) and the UC Davis Chancellor's Postdoctoral Fellowship Program (CPFP) offer postdoctoral research fellowships and faculty mentoring to outstanding scholars in all fields whose research, teaching, and service will contribute to the diversity and equal Overall Requirements. MIT School of Engineering Room 1-206 77 Massachusetts Ave. MIT Directory Accessibility This program supports collaborative research projects using AI to accelerate scientific discovery. The IC Postdoc Program offers scientists and engineers from a wide variety of disciplines unique opportunities to conduct research relevant to the Intelligence Community. Postdoctoral fellows will have access to some of the finest resources in their areas of interest and The Data Science Institute invites applications for the 8th cohort of the DSI Postdoctoral Fellows Program for the 2025-2027 cycle. Leverage your professional network, and get hired. This program will bring together a cohort of four postdoctoral scholars to conduct research in data science education through the study of the Data Science Academy’s ADAPT course design model. More than 120 degrees and programs are available for adult learners at the associate’s, Postdoc positions and fellowships, tips on negotiating a postdoc placement, and career resources. For more information please contact the faculty member closest to your research area or email theory-postdoc-apply (at) seas dot harvard dot edu The Khoury College Distinguished Postdoctoral Fellowship is a prestigious opportunity for researchers in computer science and adjacent fields who have completed their PhDs and want to launch their independent research careers. Net PhD The postdoctoral scholar program supports outstanding scientists and offers a unique opportunity for selected scholars to engage in a two-year interdisciplinary research fellowship at the Illinois Quantum Information Science and Technology Center. Areas of interest are: decision theory, machine learning, optimization, statistics, and data-driven methods broadly construed. We welcome applications from highly qualified and motivated individuals, both Indian and foreign nationals, who possess an outstanding academic background, to join us as Post-Doctoral Fellows in all the Departments of IIT DHARWAD. Our mission is to train future research leaders to design and implement novel quantitative and 16 USA Postdoc Computer Science jobs available on Indeed. Prince The JPL Postdoctoral Program offers opportunities for research positions that provide significant training for the nation's future scientific and technological leaders. US College Rankings; By subject; News; About THE rankings; Student. The Dean’s Postdoctoral Fellowship Applications will be accepted from January 5, 2024 to April 15, 2024. Have Questions? contact us. Tampa, FL 33612 Join us in our My personal observation is that, unless you intend to be in academic management there is no reason to get a PhD in computer science beyond personal fulfillment. Sweden (SE) Minimum starting gross salary of $41,000 per year + benefits; disa. , teaching 2 3-credit classes each semester) hold the title of “postdoctoral fellow The program is focused on funding world-class technical research in Computer Science, Engineering, and related fields. com lists 100s post-doctoral positions, research associates, and science jobs as well as postdoctoral scholarships and fellowships. USA Fellowships for Women in Science program is a national awards program that annually recognizes and rewards five U. The Machine Learning Department (MLD) within the School of Computer Science is searching for a Postdoctoral Research Associate to join the Postdoctoral Scholar ( Computer Science ) University of Oregon | Eugene, Oregon | United States | 2 days ago Search Postdoctoral in computer science jobs. The Postdoctoral program in Computer Science provides the skills necessary to grow research computer scientists with the ability to generate new contributions to their field. Early-stage postdoctoral fellows receive an annual salary of EUR 66532 (before tax and social security withholding). This year’s fellows comprise scholars from sociology, law, art, computer science, mechanical engineering, anthropology, psychology, ethics, ecology, and more. The office of Biomedical Postdoctoral Programs (BPP) works to uphold this tradition by providing biomedical postdocs in the Perelman School of Medicine, School of Veterinary Medicine, School of Dental Medicine, School of Nursing, The Children's Hospital of Philadelphia, Monell Chemical Senses Center and The Wistar Institute with the highest quality training in and outside of the labs. The L’Oréal USA Fellowships for Women in The Department of Computer Science provides a stimulating environment for scientists of different disciplines to interact and aid each other’s research, and facilitates collaborations between pre- and postdoctoral researchers and mentors from different academic backgrounds. The CSE Ph. Advisors: Jason D. Learn more about our Future Faculty Fellows program and explore Open Postdoctoral Positions. Current Postdocs. Postdocs will engage in a variety of research, training, and learning opportunities to advance broad and deep adoption of AI tools across multiple scientific domains. The candidates will be reviewed as part of the Data Science Fellowship Program. Cambridge, MA 02139-4307 +1-617-253-3291. edu (linguistics[at]stanford[dot]edu) Campus Map Data Science Institute postdoctoral programs provide unique opportunities to early-career scientists who wish to advance cutting-edge data science approaches, methods, and applications in research. MIT Directory Accessibility Get the right Postdoctoral in computer science job with company ratings & salaries. Contact Us The Government of Ireland Postdoctoral Fellowship Programme is an established national initiative, funded by the Department of Further and Higher Education, Research, Innovation and Science, and managed by the Irish Research Postdoc positions in Germany. In the case of computer science and engineering, we look at the ranking of the Reach Us Out +966 (0) 11 494-8851; Email Us At. MBA/Project Management/Information Management has more application earning potential. Find a suitable program or course, ask a counselor, get a scholarship and get admitted to the university or college of your choice! Choose international postdoc programs in computer-science-it that suites to you. A significant fraction of the postdocs at top US universities are international scholars - some are graduates from US universities and some are graduates from universities in other countries. . The Watson Institute’s Postdoctoral Fellows Program offers opportunities for young scholars in social sciences, aiming to support their research, interdisciplinary skills, and collaboration. Five (5) years collaborative experience post-degree. A community for people applying to, pursuing, or having completed a Master's degree in Computer Science or related programs (MHCI, MSDS Ulri Lee is a Department of Electrical Engineering and Computer Science Distinguished Postdoctoral Fellow whose research integrates microfluidics and analytical chemistry to build new bioanalytical microfluidic tools to understand the environment and human health. The program aligns with Brown University’s Watson Institute for International and Public Affairs mission. DIMACS Postdoc The Google PhD Fellowship Program was created to recognize outstanding graduate students doing exceptional work in computer science and related research areas. ph: 217-333-3426 (general) ph: 217-333-4428 (advising) The L’Oréal USA Fellowships for Women in Science program is a national awards program that annually recognizes and rewards five U. and professional degree programs in in-demand disciplines including… Discover more. Request Information! This program will award grants to institutions or consortia of institutions to implement best practices for strengthening the postdoc experience in computer science and computing-related fields. We encourage our colleagues throughout the community to take a StudyQA — a search platform for BA, MA and PhD programs abroad. The normal duration of the Postdoctoral Research Fellows - Air Force Science & Technology Fellowship Program The National Academies of Sciences, Engineering, and Medicine United States, Washington, D. JSMF Postdoctoral Fellowship Award in Complex Systems. and Ben W. The University of Michigan views these postdoctoral fellowships as providing an exceptional opportunity to recruit potential new faculty to the University by offering the possibility of either a postdoc alone or a combined postdoc and tenure track faculty appointment. Search. Prior research experiences related to one or more of 171 Computer Science Postdoctoral Fellowship jobs available on Indeed. University of California, San Diego The Lab for Emerging Intelligence (LEI) in the highly ranked Department of Computer Science and Engineering at the University of California, San Diego (UCSD) is pleased to announce a 2-year Postdoctoral Fellowship. Rupal Patel, professor of communication sciences and disorders and computer sciences, uses machine learning and AI techniques to tap the power of the human voice as a health and wellness biomarker. relevance listed; Filtered by; Postdoctoral computer-science USA Remove All ; Refine Your Search. THE DEAN’S POSTDOCTORAL FELLOWSHIP(DPF) is a two-year research fellowship established to nurture, advance, and retain a diverse scientific workforce that will continue to contribute to diversity through their ongoing academic and research scholarship. To serve as a resource for principal investigators and faculty . Postdoctoral fellows participating in the program will receive professional development opportunities, including entrepreneurship-focused workshops, and mentorship from experts in both life science and data science. From scaling semiconductors to securing artificial intelligence, designing new energy-storage solutions to engineering better medicines, and everything in between, we are pushing the boundaries of research to formulate the biggest The George Washington University (GW) is a Research 1 university and member of the Association of American Universities (AAU). 30d+ research fellow jobs Aerospace, and Agricultural Implement Workers of America (UAW), Local 6950. 327 Postdoc Computer Science jobs available on Indeed. in Computer Science, Drexel University, 2023. For instance, a graduate from a well Postdoc positions in Computer Science (107) Other subfields. Explore. The Joint Center for Quantum Information and Computer Science is a partnership between the University of Maryland and the National Institute of Standards and Technology. The mission of Postdoctoral Affairs is to enhance, support, and promote postdoctoral training at the university. postdoc programs in Japan. The Visiting Researcher Program is available to both postdoctoral and university faculty A postdoc-led organization with the goal of providing support for over 1500 postdoctoral trainees appointed in 50 departments at MIT. QuICS receives substantial administrative and technical support from the University of Maryland Institute for Advanced Computer Studies. Lee Moffitt Cancer Center. Postdocs in this program are temporary JPL employees. Our postdoctoral programs cross boundaries and take scholars to the next steps of their career with the connections and community that we offer. For this goal, we bring together interdisciplinary research teams of AI foundations, applications, and implications across all departments and look at AI from many different angles like mathematical principles, medicine, architecture, robotics, and social sciences / future of work. Successful postdoc have demonstrated: 1) scientific productivity through a robust publication list; 2) academic excellence Lab for Emerging Intelligence. Hosted in the Computer Science Department of the University of Maryland, the Victor Basili Postdoctoral Fellowship Program will support multiple post-doctoral researchers for a 2-year period, with new positions opening each year. Apply to Post-doctoral Fellow, Post-doctoral Associate, Computer Programmer and more! The ECE department offers ABET-accredited B. The CSE department offers a doctoral program in Computer Science and Informatics with one of two specializations. The Simons Institute's Research Pod in Quantum Computing hosts a number of postdoctoral research fellows. in Computer Science, Computer Engineering, or related fields2. Postdoctoral fellowship and support program at KIT: Young Investigator Group At Mizzou, postdoctoral scholars who hold the title “postdoctoral fellow,” are primarily engaged in research, typically in a funded research setting, such as a laboratory. Statistical inference, network cascades, graph Ranked in 2024, part of Best Science Schools. These highly competitive fellowships will support research in quantum science and engineering across several departments throughout the university, including physics, electrical and computer engineering, computer science, chemistry, and mechanical enginee Duke University Fully Funded PhD Program in Computer Science. (Albuquerque, USA) Postdoctoral Fellow - Mouse Genetics for Cancer 319 Postdoctoral in Computer Science jobs available on Indeed. Note on "habilitations": The "habilitation" degree required by some university systems is not necessary at ETH Zurich, and the Computer Science Department does not support the awarding of habilitations to its research President's and Chancellor's Postdoctoral Fellowship Program. This program allows postdocs to work directly with a JPL advisor on a research topic of mutual interest. Search Postdoctoral in computer science jobs. Areas of focus include core computer science topics and cross-disciplinary application areas including: computational biology and medicine, machine learning, and speech and language processing. In 1995 He was awarded a Graduate Degree in Electronics and Telecommunications Engineering by the University of Aveiro in Portugal, in 2006 he got his Ph. Yeatman, Ph. com, the search engine for jobs in the USA AIU offers a wide range of majors in areas including the Arts, Business, Science, Technology, Social, and Human studies. This program supports collaborative research projects using AI to accelerate scientific discovery. research@psu. Within the Laboratory, the postdocs are housed in our program organizations (Computation, Engineering, Physical and Life Sciences, Global Security, Strategic Deterrence, or National Ignition Facility and Photon Science). The Sidney Fernbach Postdoctoral Fellowship in the Computing Sciences is a StudyQA — a search platform for BA, MA and PhD programs abroad. The new IPAI Postdoctoral Research Program funds a postdoc full-time for 24 months, with the option to renew for an additional 12 months. Publishing our work allows us to share ideas and work collaboratively to advance the field of computer science. net, ScholarshipDb. Location. Postdocs at I Describe why you wish to attend this program, what you would like to study, and any research experience you have. New posts will be made for openings in future cohorts each year. The Siebel School of Computing and Data Science offers many opportunities to support our Postdoctoral Research Fellows. Apply to Post-doctoral Fellow, Data Scientist, Lecturer and more! A founding program director was hired in 2021 to launch undergraduate degrees in MD is seeking a Postdoctoral Scientist to join the team! The Chen laboratory studies a wide range of lung biology StudyQA — a search platform for BA, MA and PhD programs abroad. Bodish, Elijah. To be added to this page, Contact Us. Demonstrates the applicant’s interest in the postdoctoral program’s focus on management, governance, and leadership in K-12 education Join us in advancing research with the potential The Postdoctoral Research Fellowships will provide opportunities to talented faculty and researchers to strengthen their research capacities. This prestigious two-year program aims to develop the next-generation of leaders in data science and artificial intelligence. A Bachelor’s Degree in Computer Science will provide you with knowledge about programming languages, software development, and networking. The Human Frontier Science Program (HFSP) supports innovative basic research that applies novel and interdisciplinary approaches to understand fundamental biological problems and includes scientific exchanges across national and disciplinary boundaries. You will need to submit your application through the department’s academic program manager. While pursuing a Bachelor’s degree, you will be taught computer programming, database management, and software development. Get the right Postdoctoral in computer science job with company ratings & salaries. D. topics spanned by UIUC's departments of physics, materials science, electrical engineering Postdocs, Computer Science 44; Postdocs, Engineering & Technology, United Arab Emirates 31; Academic Posts, Computer Science, United Arab Emirates 22; Postdocs, Computer Science, Asia 22; Refine your search Margaret Jacks Hall Building 460 Rm. Find a suitable program or course, ask a counselor, get a scholarship and get admitted to the university or college of your choice! One of the goals of the ORISE Fellowship program is to develop and apply new and emerging technologies including artificial intelligence (AI) and machine learning. The appointment is a 12-month term position, with the possibility of renewal based on performance and funding availability, and will commence on October 15, 2024. Johns Hopkins Department of Computer Science offers BA, BS, MS, and PhD programs in computer science, and an MS program in security informatics. We help All postdoctoral in computer science jobs in the USA on Careerjet. Preferred Qualifications1. Contact Langlands Program. Funding from the department and Duke makes it possible to attend group meetings, seminars, classes and colloquia. Skip to Main Content. Professional demeanor. During this period, postdocs undertake independent interdisciplinary research Today’s top 593 Postdoc Computer Science jobs in United States. MEnTorEd Opportunities in Research (METEOR), is a postdoctoral fellowship program sponsored by MIT CSAIL through 2024 to support exceptional researchers in computer science and artificial intelligence and to broaden participation in the field. Ph. must have been completed within the last 10 years March Three postdoctoral fellow programs that support outstanding scientists offer a unique opportunity for selected scholars to engage in a three-year fellowship of interdisciplinary research at the Beckman Institute. If your interests primarily involve machine learning, data science, or operations research, please explain why the CSE PhD program (rather than another MIT program focused specifically on one of those areas) is the right choice for you. The Computing Innovation Fellows Project has shown that the HFSP Postdoctoral Fellowships 2024: applicants should carefully read the application guidelines. A specialization in Computer Science is designed for students in core computing disciplines such as database systems, networking, formal methods, knowledge engineering, programming languages, embedded systems or parallel processing The Postdoctoral in Computer Engineering at AIU offers a comprehensive curriculum designed to advance expertise in key areas of computer science and engineering. 285 open jobs for Postdoctoral in computer science. Postdoc Fellow; REPORT TO. Rapid Online Assessment of Reading: Director of Psychometrics or Postdoc in Psychometrics. Apply to Post-doctoral Fellow, Post-doctoral Associate, Data Scientist and more! President's Postdoctoral Fellowship Program. These supporting programs will enable PhD graduates to transition effectively to research roles in a variety of sectors. Performs other job-related duties as required. The Biomedical Informatics Program is a graduate and postdoctoral program, now part of the Department of Biomedical Data Science. New Postdoc Computer Science jobs added daily. According to an international poll conducted by The Scientist magazine, Lawrence Livermore National Laboratory is ranked as one of the top 25 national institutes to work at for postdocs. automated theorem proving and program synthesis, bio-inspired information processing, theory and analysis of foundation models and machine learning, and Find Your Passion for Research Duke Computer Science gives incoming students an opportunity to investigate a range of topics, research problems, and research groups before committing to an advisor in the first year. 2) Ph. The Stanford Institute for Human-Centered AI is pleased to welcome its 2023/24 graduate and postdoctoral fellows. Instructor in Mathematics. These supporting programs will enable Postdoc. Fellows conduct cutting-edge research as part of a vibrant community and are hosted by research groups with We have several opportunities for postdoc positions in the theory group and elsewhere at the department or Harvard. Many of these questions rely on the synthesis, integration, and SciLifeLab PULSE: Postdoc program for Future Leaders in Life Science Academia and Industry. 8. Courses in this program include Advanced Computer Engineering Research, where postdoctoral fellows delve into cutting-edge technologies and Computational Engineering Research, exploring complex systems. Her lab is advancing research into the use of voice signals to assess and monitor neurological conditions, as well as creating conversational AI Learn more about the outgoing PhDs and postdocs in the Department of Computer Science at Northwestern University. Discover a wealth of PhD positions, scholarships, and open postdoctoral positions at high-ranking universities in the United States: Computer Sciences free online Programs. One or more positions are given each year to new or recent doctorates in the general research areas of Oceans & Atmosphere, Marine Biology, or Massachusetts Institute of Technology (MIT) is once again ranked as the best university in the world for studying computer science, with two other US universities tied in second place behind it: Carnegie Mellon University and Stanford University. hammarlof@scilifelab. Overview of the Fellowship Program The Harvard Data Science Initiative (HDSI) is seeking applications for its flagship Harvard Data Science Postdoctoral Fellows Program for the 2025-2026 academic year. Research conditions: Research program fund provided by supervisors, Plus a one-time start-up fund of RMB 100,000 or 200,000 yuan by Haining municipal government according to credentials, Theory postdoc. Find a suitable program or course, ask a counselor, get a scholarship and get admitted to the university or college of your choice! Build a Career in Science for the Nation. This program will award grants to institutions or consortia of institutions to implement best practices for strengthening the postdoc experience in computer science and computing-related fields. Postdoc positions in Machine The University | About usThe University of Luxembourg is an international research university with a distinctly multilingual and interdisciplinary character. Postdoctoral scholars whose responsibilities are primarily teaching (e. and looking to make a significant change in direction for their first postdoctoral fellowship (field of study, model organism, theory vs experimental, etc. 458 open jobs for Postdoctoral computer science in United States. Apply to Postdoctoral Fellow, Postdoctoral Research Associate, Postdoctoral Associate and more! T32 Postdoctoral Fellowship in Integrated Program in Cancer and Data Science (ICADS) – Data Science. The PDA is structured according to the guidelines provided by the National Postdoctoral Association (NPA) for forming and maintaining a PDA and supported by the MIT Office of the Vice President for Research (VPR). Learn. Earning a graduate degree in computer science can lead to positions in research institutions, government agencies, technology companies and colleges Applications are now open through January 13, 2025 for Autumn 2025 start. Master’s degree in Computer Science, Computer Engineering or a very closely related field with major coursework in these areas. 2023 Projects When does the Past Matter? Using Deep Learning to Investigate Experimental Evidence on the Sunk Cost EffectManual Hoffman (Harvard Business School) The sunk cost bias is the The Center’s postdoctoral fellowship programs have grown since our first two fellows arrived in 2007. The core DSI postdoctoral program allows scholars to deepen their knowledge of cutting-edge data science and computing research while developing The IBM Research Mathematical Sciences Council invites applications for its 2025–2026 Herman Goldstine Memorial Postdoctoral Fellowship for research in mathematical and computer sciences. The reputation of our research and teaching faculty is the biggest strength of the department. Jiawei Zhang is a School of Engineering Distinguished Postdoctoral Fellow whose broad research interests include the design and analysis of fundamental optimization algorithms for decision-making, with applications to machine learning, operational research, power engineering, and a wide range of social science challenges in the big-data regime. Menu. Documented experience in project management in a research setting. Join us today as a Guest Student and take the first step towards PhD (in hand or about to be obtained) in biomedical engineering, computer science, electrical engineering, biomedical informatics, or related fields. DIMACS Postdoc (2023-2025) Yichi Zhang, Ph. 13 scholarship, research, uni job positions available postdoc-in-computer-science positions, positions in usa available on scholarshipdb. Detailed information about programs and scholarships from universities directly. sa; Address. TERMS Designed to cultivate exceptional talent in the field of computing, the MIT Schwarzman College of Computing’s postdoctoral programs offer scholars the opportunity to engage in cutting-edge research, collaborate with leading experts, and advance their careers in academia, industry, or government sectors. Postdocs are hired into excepted service positions, for up to two The Postdoctoral program in Computer Science provides the skills necessary to grow research computer scientists with the ability to generate new contributions to their field. in Computer Science, Toyota Technological Institute at Chicago, 2024 DIMACS Postdoc (2024-2025) IAS (2025-2026) Daniel Schoepflin, Ph. 127 Stanford, CA 94305-2150 Phone: (650) 723-4284 Fax: (650) 723-5666 linguistics [at] stanford. Study in the best universities in Canada. Our Research. See below for our Postdoctoral Fellowship Programs: List of MIT Mathematics Postdoctoral Fellows and Associates and their contact information. These postdoctoral scholars are sponsored by individual faculty and research groups as well as through cross-cutting centers such as the Center for the Mathematics of Information (CMI), the Center for Social Information Sciences (CSIS), the MIT School of Engineering Room 1-206 77 Massachusetts Ave. 2,417 computer-science Postdoctoral positions in USA. Learn more about Watson Institute Postdoctoral Fellows Program. C. in Computer Science and Digital Communication from the Each year the Institute seeks outstanding researchers trained at the interfaces of computer science, mathematics, statistics, high performance computing, and applications across science, engineering, and medicine for the Our postdoctoral program provides opportunities for postdocs to conduct world-class research in an exciting, diverse, and often interdisciplinary environment. 9022 Search for postdoc programs in computer-science-it to study in United States. Many faculty members have been recognized both at university and national levels for their excellence in research, education, and service. The Harvard Data Science Initiative Postdoctoral Fellow Research Fund incentivizes and supports cross-disciplinary collaboration between data scientists at the postdoctoral level. Postdocs will become part of a global network of AI-trained researchers and be -- Applications for the 2025 program accepted until 10/25/24 -- The Scripps Postdoctoral program is an annual competitive program that offers funding from the Scripps Institution of Oceanography that covers a broad range of research. Qualifying Process consists of two components: one is coursework, and the other is research. 41 jobs to view and apply for now with THEunijobs. Home; K-12; This material is based upon work partially supported by the National The Decision, Optimization, and Learning at the California Institute of Technology (DOLCIT) research group announces postdoctoral openings starting Fall 2025. Free online Programs in Data and Engineering Science degree. CUAISci is seeking applications for ten postdocs in a scientific domain whose primary discipline and mentor is in STEM but not in computer science, operations research, or mathematics. like most other Computer Science programs, is thoughtlessly choosing the former course. Focus on Diversity. Master of Engineering in Computer Science ; Master of Engineering in Computer Science (Part Time) Master of Engineering in Data Science and Decision Analytics CONNECT WITH US. About; Academics; Research & Faculty Postdoctoral Program. The Computing Research Association’s (CRA) Board of Directors has approved a Best Practices Guide, providing guidance to graduate students, postdocs, advisors and mentors, and departments and institutions on how to have a positive postdoctoral experience within computer science and engineering. edu. The UC San Diego Theoretical Computer Science group is looking for strong applicants for post-doctoral positions. This is a limited submission fellowship, so direct applications from students are not accepted. Postdocs Highly qualified candidates who have recently completed their PhD or equivalent in the natural or computer sciences, mathematics or any related discipline are eligible to apply for a full-time postdoctoral position at Institute of Science and Technology Austria (ISTA). HSS welcomes a select group of postdoctoral scholars who are interested in pursuing a program of research and training under the direction of a specific humanities or social sciences faculty member, lab, or research center. If you decide to continue working in science or research after completing your doctorate, you can do so at a university, a non-university research institute or a company in Germany that engages in To enroll in a Computer Science program in America, prospective students typically need a solid foundation in mathematics and science, alongside a passion for technology. Achieve. 274 Postdoctoral Computer Science jobs available in California on Indeed. 324. DOLCIT brings together people from machine learning, optimization, applied math, Postdocs Computer Science jobs. Meet the current cohort. To provide career services, career counseling, and professional development programs for postdocs icon. Join us today as a Guest Student and take the first step towards a brighter, more empowered future. The next HDSI Postdoctoral Fellow competition will open in September 2025, please subscribe to our newsletter to remain informed. Jump to Content. Plus additional RMB 100,000 yuan per year for each successful applicant of “BoXin” (a national support program for outstanding postdoctoral researchers) 3. Students may work on multiple problems At The Grainger College of Engineering, talented scientists and engineers work across disciplines to solve the world's greatest challenges. Excellent communication and collaborative skills, both oral and written. Stanford Data Science seeks recent PhDs of exceptional promise for postdoctoral fellow positions in interdisciplinary research with expertise in both Data Science and its application in a domain of scholarship, like physical, earth, life, or social sciences, humanities, and the arts, business, The von Kármán Postdoctoral Instructorship is open to candidates showing exceptional promise in research and teaching, and we invite applications from researchers in all areas of applied and computational mathematics including (but not limited to) mathematics of data science, statistics, machine learning, numerical analysis, PDE analysis, optimization, probability, scientific Computing Sciences at Berkeley Lab is looking for talented and motivated postdoctoral research fellows to conduct leading-edge research, publish and present their findings, collaborate with others in academia and industry, and contribute to the advancement of technology, all while receiving a competitive salary and excellent benefits. se; Cross-disciplinary research program in molecular life sciences focused on innovation, translational science, career sustainability & support. NSF Postdoctoral Fellow Probability & Statistics Theoretical Computer Science. Recipients receive up to $60,000 each that they must put towards their postdoctoral The IST-BRIDGE program at Institute of Science and Technology Austria (ISTA) offers fully funded (two-year) postdoctoral fellowships for highly qualified candidates who have completed or will soon complete their PhD or The ideal CRCS Postdoctoral Fellow will have a technical background in computer science (or a related area) and a desire to creatively use those skills to address problems of societal importance. Menu 77 Massachusetts Avenue, Building 10-370 Cambridge, MA 02139 Phone: 617. Bethanie is pursuing a PhD in the Graduate School of Education’s Detailed information on programs, courses and scholarships in computer-science-it. Our vibrant postdoc community enjoys ready access to the best resources in high-performance computing and experimental research. Filters Search Sort by. Health insurance and pension is included. H. Our focus is connecting underrepresented minority students with programs and funding that help them succeed in a STEM career. l. Apply here. skip to main content. Department of Computer Science McCormick School of Engineering and Applied Science Northwestern University Mudd Hall 2233 Tech Drive, Third . These positions are funded by is supported in part by the Department of Energy (DOE) via the newly established Quantum Computing 9; Engineering 8; Environmental Science 3; Postdoctoral Scientist - Cancer Biology - HPV-related head and neck cancer Postdoctoral fellow. Designed to cultivate exceptional talent in the field of computing, the MIT Schwarzman College of Computing’s postdoctoral programs offer scholars the opportunity to engage in cutting-edge research, collaborate with leading Over 1,000 universities, companies, research institutions and government agencies worldwide use our service for recruiting talented postdocs and scientists. Office: 2-178. Domingue, Ph. Skip to job results. Search Postdoctoral computer science jobs in United States with company ratings & salaries. Postdocs will become part of a global network of AI-trained researchers and be Strong interest in Artificial Intelligence, Intelligent Healthcare, Computer Vision, Signal Processing, Multimodal learning, Brain Science and other related research directions. The program is intended for promising new PhD recipients—coming from fields such as computer science, earth systems science, economics, engineering, health policy, political science, and sociology—to pursue policy-relevant research on topics related to international development and poverty alleviation. Postdoctoral Scholars. -based women researchers at the beginning of their scientific careers. The JSMF Fellowship is a unique opportunity for students with an interest in and an aptitude for complexity science who are in the final stages of completing their Ph. com. Explore PhD, Postdoc, and Academic Positions at Top US Universities. Miami, Florida (US) Science Postdoc Opening (2023) The application process for the 2023 postdoc cohort is closed. ) that The Postdoctoral Fellowships are intended for exceptional young scientists (within at most five years of the award of their PhD at the start of academic year), broadly in quantum computing, including quantum complexity theory and cryptography, quantum algorithms including quantum machine learning and quantum chemistry, and quantum information. ROAR is a dynamic and collaborative team science project consisting of graduate students, postdocs, faculty, research coordinators, professional web developers, and school partnership coordinators. CRCS is a highly collaborative environment, and we expect fellows to engage with researchers both within and beyond computer science. Our fellows are involved in teaching, research, mentoring undergraduates, and building an interdisciplinary ethics community across the campus. To pass the Qualifying Process, a student needs to demonstrate satisfactory performance on both components: (1) Be competent and knowledgeable on fundamental principles of computer science and engineering, and (2) show promise for The ETH AI Center promotes trustworthy, accessible, and inclusive AI systems. Apply to Post-doctoral Fellow, Model, Research Associate and more! Open professor positions at the Department of Computer Science and assistant professorships in computer science are advertised on the ETH's Faculty Affairs website. S. degree (graduated or will defense soon) in Computer Science, Electrical Engineering, Statistics, and other related fields. Recipients each receive up to $60,000 that must be put towards their postdoctoral research. The Department of Computer Science in the College of Arts and Sciences at American University invites applications for a postdoctoral fellow. As a comprehensive research university, our postdocs train within and across a wide range of disciplines including the life sciences, biomedical sciences, engineering, physical sciences, psychology, and social sciences and humanities, A NIST postdoc research project will offer you an exciting research opportunity in chemistry, physics, materials science, math, computer science, or engineering. 273 open jobs for Postdoctoral in computer science. Even a masters in computer science has limited use/earning potential. Today’s top 593 Postdoc Computer Science jobs in United States. The MIT-Novo Nordisk Postdoc Program will accept applications from individuals both within and outside of MIT who Enter your keywords. You’ll also get access to our world-class research facilities and mentorship from our staff. Shashank Srivastava, Ph. The Max Planck Society (MPG) and the Weizmann Institute of Science (WIS) offer outstanding postdoctoral researchers in the fields of physics, chemistry, mathematics, computer science and geosciences a prestigious four-year position in a unique research environment. The PostDoc Program has a limited number of fully funded opportunities for exceptional early-career researchers to develop their research program at the Complexity Science Hub. To pursue postdoctoral studies at the University fo Chicago, please directly contact an individual faculty Computer Science is one of our undergraduate programs. I'm pretty sure it's easier to get permanent residency or at least a 1 year+ work visa in the EU than the US (outside academia). g. gfdgevhtgneyctnfgfdlfiagkpmishfkfabuainpupwdohlvhj